PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011072642.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 300aa    MW: 33666.5 Da    PI: 6.6185
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011072642.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.71.9e-3842140199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dCvlapyfp++++++f n+h+lFG+sn++k++++l++  +++am++++++++ara dPv G++++i++l+q+++ +kael+
  XP_011072642.1  42 ACAACKYQRRKCASDCVLAPYFPHDRQRQFLNAHRLFGVSNIVKIVRHLDPPAKDHAMRTIIFQSDARAADPVGGCHRIIRDLEQRISLAKAELE 136
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                      + +
  XP_011072642.1 137 IVLH 140
                     8766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1741142IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-3642137IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MHNNKKSNIT SIINNNNNTK NITRTTSVPL SHPRSHGSTT QACAACKYQR RKCASDCVLA  60
PYFPHDRQRQ FLNAHRLFGV SNIVKIVRHL DPPAKDHAMR TIIFQSDARA ADPVGGCHRI  120
IRDLEQRISL AKAELEIVLH HLALCRAAAT QQQVVPAPDC GGSYDEKWRV PYVAEDEAVT  180
VDDVNSWGCM PGNVHTNAES TSSSFPHHND NSNHHHMRKL SVEECNNDVL PILDHLTCDD  240
DVREEDFKFD HHGNIVPSSN GILTEEKGTF KEDDDCFSYV QDHHDLKAAA TFFSLTNCDI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011072642.10.0PREDICTED: LOB domain-containing protein 7-like
TrEMBLA0A022S0S31e-113A0A022S0S3_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000124981e-59(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA99262126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.15e-50LOB domain-containing protein 22